NLSExplorer Result Page
Position | Prediction type NLS indicates Nuclear Localization Signals, NIA means potential Nuclear Import Area in protein sequence. | Length | Recommendation score | Entropy score | Rcommended NLS segment |
128-165 | NLS | 38 | 0.99418 | 3.78935 | SATGTKRKLDEYLDNSQGVVGQFNKIKLRPKYKKSTIQ |
455-460 | NIA | 6 | 0.10788 | 1.25163 | KKVKKE |
518-525 | NIA | 8 | 0.01108 | 3.0 | VIQKYNRF |
564-579 | NIA | 16 | 0.00883 | 3.25 | AITFAEQKLNCKYKKF |
390-395 | NIA | 6 | 0.00761 | 2.58496 | SQILKY |
414-419 | NIA | 6 | 0.00569 | 1.9183 | LNLIVN |
364-372 | NIA | 9 | 0.00461 | 2.9477 | LPIMLSRKE |
529-556 | NIA | 28 | 0.00386 | 3.57856 | MFVIGKVNRRESTTLHNNLLKLLALILQ |
491-496 | NIA | 6 | 0.00376 | 2.25163 | EERLTI |
257-262 | NIA | 6 | 0.00355 | 2.25163 | MVDNRV |
377-382 | NIA | 6 | 0.00347 | 2.25163 | ETASNN |
107-112 | NIA | 6 | 0.00317 | 1.45915 | PSPSSA |
31-36 | NIA | 6 | 0.00315 | 2.58496 | KQPNDY |
336-346 | NIA | 11 | 0.00308 | 2.84535 | LLQSLGERKCG |
14-20 | NIA | 7 | 0.00263 | 2.12809 | STPSRAS |
6-11 | NIA | 6 | 0.00233 | 2.58496 | FNASYT |
43-48 | NIA | 6 | 0.00223 | 2.25163 | PTPDGA |
81-86 | NIA | 6 | 0.00201 | 2.25163 | KTTDNL |
54-77 | NIA | 24 | 0.00194 | 3.07393 | DSETAAASNFLASVNSLTDNDLVE |
Attention distribution along the sequence
Sequence visualization according to the attention map

The structure statistical of recommended segment
The recommended segment visualization on 3d structure
The green, blue, and yellow regions refer to the top three recommended NLS,
while the red region represents other potential NLS regions